PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G171000.1.p
Common NameSb06g024630, SORBIDRAFT_06g024630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 419aa    MW: 42661.5 Da    PI: 9.5119
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G171000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.6e-41139215177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +CqvegC++ l++ak+yhrrhkvCe+hskap v+v g eqrfCqqCsrfh++sefDe+krsCrrrLa+hnerrrk++
  Sobic.006G171000.1.p 139 RCQVEGCHVALADAKDYHRRHKVCEAHSKAPRVVVLGAEQRFCQQCSRFHAISEFDEAKRSCRRRLAGHNERRRKSN 215
                           6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-35135201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.676137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38138217IPR004333Transcription factor, SBP-box
PfamPF031105.9E-32140213IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MEGNGGAGGG SGSAAPPWDL AMHWAPSAGS SYPQQPLALR PGGVPSSQLQ LLHQQQQQQQ  60
QELTCLKLGK RPACCWAGAA LGSQVVAAQA GAGLPHHLHG NGGGAAAGCG GGASGKAAEG  120
KRKEKQAAAA APGAAAVPRC QVEGCHVALA DAKDYHRRHK VCEAHSKAPR VVVLGAEQRF  180
CQQCSRFHAI SEFDEAKRSC RRRLAGHNER RRKSNASEAM ARGAAHPHGV TAFGHGFLPP  240
CGGLSGSSAG ALSLLSSARS GATSAAPWQV TTSDISARSS AALDDLIAEN RAALLAWQYF  300
SDRSSSAPGR HFASSSSTAT GCALPPADDQ HAAASWRPHP HSGVGGGRHH MAPPGVWHTT  360
LDLMQTASSA APATSTGAPF RPVPERAGAR PRGKSKDGDD ASGCSLDAWA PAGGARVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-32131213284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0546541e-150BT054654.2 Zea mays full-length cDNA clone ZM_BFb0036O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446904.10.0hypothetical protein SORBIDRAFT_06g024630
SwissprotQ01JD11e-109SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLC5YDH80.0C5YDH8_SORBI; Putative uncharacterized protein Sb06g024630
STRINGSb06g024630.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-35squamosa promoter binding protein-like 10